Abstract:
AIM To synthesize fragments of inhibin subunits βA(1-28) (GLECDGKVNICCKKQFFVSFKDIGWNDW), βA(82-114) (VPTKLRPMSMLYYDDGQNIIKKDIQNMIVEECG) and to obtain their monoclonal antibodies. METHODS The fragments of inhibin subunits α(37-65), βA(1-28) and βA(82-114) have been synthesized manually by stepwise solid-phase procedure. These peptide products were conjugated with TG as antigens to prepare McAbs against inhibin α and βA subunit. After immunization, fusion, selection and cloning procedures, seven hybridoma cell lines were obtained. Ascites titer, specificity and relative affinity were identified. RESULTS These McAbs were shown to be highly special, sensitive and useful in detection tests. Initial immunohistochemistry test gave some important information for clinical utility. CONCLUSION The method of detecting serum inhibin level will be established on basis of the present research.